| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase inhibitor 1 |
|---|
| Ligand | BDBM50410018 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_312419 (CHEMBL832970) |
|---|
| IC50 | >20000±n/a nM |
|---|
| Citation |  Wang, YD; Johnson, S; Powell, D; McGinnis, JP; Miranda, M; Rabindran, SK Inhibition of tumor cell proliferation by thieno[2,3-d]pyrimidin-4(1H)-one-based analogs. Bioorg Med Chem Lett15:3763-6 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase inhibitor 1 |
|---|
| Name: | Cyclin-dependent kinase inhibitor 1 |
|---|
| Synonyms: | CAP20 | CDK-interacting protein 1 | CDKN1 | CDKN1A | CDN1A_HUMAN | CIP1 | MDA6 | PIC1 | SDI1 | WAF1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18123.15 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_312386 |
|---|
| Residue: | 164 |
|---|
| Sequence: | MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
|
|
|
|---|
| BDBM50410018 |
|---|
| n/a |
|---|
| Name | BDBM50410018 |
|---|
| Synonyms: | CHEMBL179187 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20ClNO3S |
|---|
| Mol. Mass. | 389.896 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)-c1cc(Cl)c2c3CCCCc3sc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
