Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-3/beta-4 subunit
LigandBDBM50161086
Substrate/Competitorn/a
Meas. Tech.ChEMBL_310813
EC50 0.550000±n/a nM
Citation Fitch RWKaneko YKlaperski PDaly JWSeitz GGündisch D Halogenated and isosteric cytisine derivatives with increased affinity and functional activity at nicotinic acetylcholine receptors. Bioorg Med Chem Lett 15:1221-4 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Name:Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Synonyms:Neuronal acetylcholine receptor; alpha3/beta4 | nAChR subtypes alpha3 beta4
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143402
Components:This complex has 2 components.
Component 1
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Neuronal acetylcholine receptor protein beta-4 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:55863.89
Organism:Rattus norvegicus (Rat)
Description:P12392
Residue:495
Sequence:
MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELS
LSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNA
DGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEI
DMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLII
PCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLF
TMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPH
PSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSS
GRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGL
FLPPLFQIHAPSKDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161086
n/a
NameBDBM50161086
Synonyms:9-Iodo-1,2,3,4,5,6-hexahydro-1,5-methano-pyrido[1,2-a][1,5]diazocin-8-one | CHEMBL62858
TypeSmall organic molecule
Emp. Form.C11H13IN2O
Mol. Mass.316.1382
SMILESIc1ccc2C3CNCC(C3)Cn2c1=O |THB:3:4:10:7.6.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: