Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM50176388
Substrate/Competitorn/a
Meas. Tech.ChEMBL_328025
IC50 50000±n/a nM
Citation Melnyk PLeroux VSergheraert CGrellier P Design, synthesis and in vitro antimalarial activity of an acylhydrazone library. Bioorg Med Chem Lett 16:31-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176388
n/a
NameBDBM50176388
Synonyms:CHEMBL199543 | N'-(2-hydroxy-5-methylbenzylidene)-4-tert-butylbenzohydrazide
TypeSmall organic molecule
Emp. Form.C19H22N2O2
Mol. Mass.310.3902
SMILESCc1ccc(O)c(C=NNC(=O)c2ccc(cc2)C(C)(C)C)c1 |w:7.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: