Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM50041457
Substrate/Competitorn/a
Meas. Tech.ChEMBL_422247
IC50 790000000±n/a nM
Citation Gemma SKukreja GFattorusso CPersico MRomano MPAltarelli MSavini LCampiani GFattorusso EBasilico NTaramelli DYardley VButini S Synthesis of N1-arylidene-N2-quinolyl- and N2-acrydinylhydrazones as potent antimalarial agents active against CQ-resistant P. falciparum strains. Bioorg Med Chem Lett 16:5384-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041457
n/a
NameBDBM50041457
Synonyms:4-[(7-chloroquinolin-4-yl)amino]-2-[(diethylamino)methyl]phenol | AMODIAQUINE | CHEMBL682
TypeSmall organic molecule
Emp. Form.C20H22ClN3O
Mol. Mass.355.861
SMILESCCN(CC)Cc1cc(Nc2ccnc3cc(Cl)ccc23)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: