Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM31774
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425633
IC50 2500000000±n/a nM
Citation Gemma SCampiani GButini SKukreja GJoshi BPPersico MCatalanotti BNovellino EFattorusso ENacci VSavini LTaramelli DBasilico NMorace GYardley VFattorusso C Design and synthesis of potent antimalarial agents based on clotrimazole scaffold: exploring an innovative pharmacophore. J Med Chem 50:595-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31774
n/a
NameBDBM31774
Synonyms:CHEMBL104 | Canesten | Clotrimazole | Lotrimin | Mycelex | US9138393, Clotrimazole | cid_2812
TypeSmall organic molecule
Emp. Form.C22H17ClN2
Mol. Mass.344.837
SMILESClc1ccccc1C(c1ccccc1)(c1ccccc1)n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: