Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnti-estrogen binding site (AEBS)
LigandBDBM50411319
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430045
IC50 70±n/a nM
Citation Burke PJKalet BTKoch TH Antiestrogen binding site and estrogen receptor mediate uptake and distribution of 4-hydroxytamoxifen-targeted doxorubicin-formaldehyde conjugate in breast cancer cells. J Med Chem 47:6509-18 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anti-estrogen binding site (AEBS)
Name:Anti-estrogen binding site (AEBS)
Synonyms:7-DHC reductase | 7-dehydrocholesterol reductase | D7SR | DHCR7 | Putative sterol reductase SR-2 | Sterol Delta(7)-reductase
Type:PROTEIN
Mol. Mass.:54508.42
Organism:Homo sapiens (Human)
Description:ChEMBL_864350
Residue:475
Sequence:
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50411319
n/a
NameBDBM50411319
Synonyms:CHEMBL266892
TypeSmall organic molecule
Emp. Form.C35H36N2O13
Mol. Mass.692.6659
SMILESCOc1cccc2C(=O)c3c(O)c4C[C@](O)(C[C@H](O[C@H]5C[C@H](NCNC(=O)c6ccccc6O)[C@H](O)[C@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: