Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin 1C
LigandBDBM50423056
Substrate/Competitorn/a
Meas. Tech.ChEMBL_443034
IC50 1175±n/a nM
Citation Tsotinis APanoussopoulou MEleutheriades ADavidson KSugden D Design, synthesis and melatoninergic activity of new unsubstituted and beta,beta'-difunctionalised 2,3-dihydro-1H-pyrrolo[3,2,1-ij]quinolin-6-alkanamides. Eur J Med Chem 42:1004-13 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin 1C
Name:Melatonin 1C
Synonyms:Melatonin receptor 1C | Melatonin receptor type 1C
Type:Enzyme Catalytic Domain
Mol. Mass.:47442.40
Organism:Xenopus
Description:Melatonin 1C 0 Xenopus::P49219
Residue:420
Sequence:
MMEVNSTCLDCRTPGTIRTEQDAQDSASQGLTSALAVVLIFTIVVDVLGNILVILSVLRN
KKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSV
FNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTIIAIVPNFFVGSLQYDPRIF
SCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHRVRQDFKQKLTQTDLR
NFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIY
GVLNQNFRKEYKRILMSLLTPRLLFLDTSRGGTEGLKSKPSPAVTNNNQADMLGEARSLW
LSRRNGAKMVIIIRPRKAQIAIIHQIFWPQSSWATCRQDTKITGEEDGCRELCKDGISQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50423056
n/a
NameBDBM50423056
Synonyms:CHEMBL243002
TypeSmall organic molecule
Emp. Form.C20H26N2O
Mol. Mass.310.4332
SMILESCC(=O)NCC1(CCCCC1)c1cn2CCCc3cccc1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: