Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid Hormone Receptor (TR-beta)
LigandBDBM50123057
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447974
IC50 1.12±n/a nM
Citation Liu HGramatica P QSAR study of selective ligands for the thyroid hormone receptor beta. Bioorg Med Chem 15:5251-61 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyroid Hormone Receptor (TR-beta)
Name:Thyroid hormone receptor
Synonyms:Nuclear receptor subfamily 1 group A member 2 | Thyroid hormone receptor | Thyroid hormone receptor beta
Type:Receptor
Mol. Mass.:52793.62
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1.
Residue:461
Sequence:
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50123057
n/a
NameBDBM50123057
Synonyms:CHEMBL124039 | N-Cyclobutyl-5-[2,6-dichloro-4-(3,5-dioxo-4,5-dihydro-3H-[1,2,4]triazin-2-yl)-phenoxy]-2-hydroxy-benzenesulfonamide | N-cyclobutyl-5-(2,6-dichloro-4-(3,5-dioxo-4,5-dihydro-1,2,4-triazin-2(3H)-yl)phenoxy)-2-hydroxybenzenesulfonamide
TypeSmall organic molecule
Emp. Form.C19H16Cl2N4O6S
Mol. Mass.499.325
SMILESOc1ccc(Oc2c(Cl)cc(cc2Cl)-n2ncc(=O)[nH]c2=O)cc1S(=O)(=O)NC1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: