Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50411683
Substrate/Competitorn/a
Meas. Tech.ChEMBL_465003
Ki 7.94±n/a nM
Citation Micheli FBonanomi GBraggio SCapelli AMCelestini PDamiani FDi Fabio RDonati DGagliardi SGentile GHamprecht DPetrone MRadaelli STedesco GTerreni SWorby AHeidbreder C New fused benzazepine as selective D3 receptor antagonists. Synthesis and biological evaluation. Part one: [h]-fused tricyclic systems. Bioorg Med Chem Lett 18:901-7 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50411683
n/a
NameBDBM50411683
Synonyms:CHEMBL408169
TypeSmall organic molecule
Emp. Form.C28H32N6OS
Mol. Mass.500.658
SMILESCc1ccc2c(cccc2n1)-c1nnc(SCCCN2CCc3cc4NCCOc4cc3CC2)n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: