Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepinephrine & serotonin
LigandBDBM50412441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_537449
Ki 3.98±n/a nM
Citation Serafinowska HTBlaney FELovell PJMerlo GGScott CMSmith PWStarr KRWatson JM Novel 5-HT(1A/1B/1D) receptors antagonists with potent 5-HT reuptake inhibitory activity. Bioorg Med Chem Lett 18:5581-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepinephrine & serotonin
Name:Monoamine transporters; Norepinephrine & serotonin
Synonyms:5-HT Transporter | 5-HTT | 5HT transporter | 5HTT | Anandamid membrane transporter, AMT | Anandamide membrane transporter, AMT | Sodium-dependent serotonin transporter (SERT) | imipramine receptor
Type:Multi-pass membrane protein
Mol. Mass.:70168.43
Organism:Rattus norvegicus (rat)
Description:P31652
Residue:630
Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50412441
n/a
NameBDBM50412441
Synonyms:CHEMBL490417 | SB-744185
TypeSmall organic molecule
Emp. Form.C24H26N4O2
Mol. Mass.402.4888
SMILESCc1ccc2c(cccc2n1)N1CCN(CCc2ccc3OCC(=O)Nc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: