Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50412441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_537453
Ki 1258.93±n/a nM
Citation Serafinowska HTBlaney FELovell PJMerlo GGScott CMSmith PWStarr KRWatson JM Novel 5-HT(1A/1B/1D) receptors antagonists with potent 5-HT reuptake inhibitory activity. Bioorg Med Chem Lett 18:5581-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50412441
n/a
NameBDBM50412441
Synonyms:CHEMBL490417 | SB-744185
TypeSmall organic molecule
Emp. Form.C24H26N4O2
Mol. Mass.402.4888
SMILESCc1ccc2c(cccc2n1)N1CCN(CCc2ccc3OCC(=O)Nc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: