Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50413247
Substrate/Competitorn/a
Meas. Tech.ChEMBL_541063
IC50 125.89±n/a nM
Citation Sanganee HJBaxter ABarber SBrown AJGrice DHunt FKing SLaughton DPairaudeau GThong BWeaver RUnitt J Discovery of small molecule human C5a receptor antagonists. Bioorg Med Chem Lett 19:1143-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50413247
n/a
NameBDBM50413247
Synonyms:CHEMBL472455
TypeSmall organic molecule
Emp. Form.C26H27FN2O5
Mol. Mass.466.5014
SMILESCOc1ccc(N(C(C(=O)NC2CCCC2)c2ccccc2F)C(=O)c2ccco2)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: