Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin V
LigandBDBM50414641
Substrate/Competitorn/a
Meas. Tech.ChEMBL_581586
IC50 2±n/a nM
Citation Bethel PAGerhardt SJones EVKenny PWKaroutchi GIMorley ADOldham KRankine NAugustin MKrapp SSimader HSteinbacher S Design of selective Cathepsin inhibitors. Bioorg Med Chem Lett 19:4622-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin V
Name:Cathepsin V
Synonyms:Cathepsin (V and K) | Cathepsin U
Type:Enzyme
Mol. Mass.:37341.06
Organism:Homo sapiens (Human)
Description:O60911
Residue:334
Sequence:
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIE
LHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDW
RKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAV
ATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50414641
n/a
NameBDBM50414641
Synonyms:CHEMBL554065
TypeSmall organic molecule
Emp. Form.C24H29N7O4
Mol. Mass.479.5316
SMILESCOCc1nnc(o1)-c1cccc(CC(NC(=O)c2cc(nn2C)C(C)(C)C)C(=O)NCC#N)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: