Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride lipase
LigandBDBM50361476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592875
IC50 912.01±n/a nM
Citation Kapanda CNMuccioli GGLabar GPoupaert JHLambert DM Bis(dialkylaminethiocarbonyl)disulfides as potent and selective monoglyceride lipase inhibitors. J Med Chem 52:7310-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride lipase
Name:Monoglyceride lipase
Synonyms:HU-K5 | Lysophospholipase homolog | Lysophospholipase-like | MAGL | MGL | MGLL
Type:Hydrolase
Mol. Mass.:33264.56
Organism:Homo sapiens (Human)
Description:Human recombinant MGL (Cayman Chemical, cat# 10008354).
Residue:303
Sequence:
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361476
n/a
NameBDBM50361476
Synonyms:CHEMBL583959
TypeSmall organic molecule
Emp. Form.C10H16N2S4
Mol. Mass.292.507
SMILESS=C(SSC(=S)N1CCCC1)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: