| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50415332 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_605640 (CHEMBL1070562) |
|---|
| EC50 | 1000±n/a nM |
|---|
| Citation |  Gleave, RJ; Beswick, PJ; Brown, AJ; Giblin, GM; Goldsmith, P; Haslam, CP; Mitchell, WL; Nicholson, NH; Page, LW; Patel, S; Roomans, S; Slingsby, BP; Swarbrick, ME Synthesis and evaluation of 3-amino-6-aryl-pyridazines as selective CB(2) agonists for the treatment of inflammatory pain. Bioorg Med Chem Lett20:465-8 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50415332 |
|---|
| n/a |
|---|
| Name | BDBM50415332 |
|---|
| Synonyms: | CHEMBL611321 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14F3N3O |
|---|
| Mol. Mass. | 309.2864 |
|---|
| SMILES | FC(F)(F)c1cccc(c1)-c1ccc(nn1)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
