Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM50415544
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612226
IC50>19000±n/a nM
Citation Hans RHGuantai EMLategan CSmith PJWan BFranzblau SGGut JRosenthal PJChibale K Synthesis, antimalarial and antitubercular activity of acetylenic chalcones. Bioorg Med Chem Lett 20:942-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Falcipain-2
Name:Falcipain-2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:55912.57
Organism:Plasmodium falciparum
Description:n/a
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDELNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50415544
n/a
NameBDBM50415544
Synonyms:CHEMBL597626
TypeSmall organic molecule
Emp. Form.C21H20O5
Mol. Mass.352.3805
SMILESCOc1ccc(C(=O)\C=C\c2cccc(OCC#C)c2)c(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: