Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM50415550
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612711
IC50 31.62±n/a nM
Citation Brotherton-Pleiss CEDillon MPFord APGever JRCarter DSGleason SKLin CJMoore AGThompson AWVilla MZhai Y Discovery and optimization of RO-85, a novel drug-like, potent, and selective P2X3 receptor antagonist. Bioorg Med Chem Lett 20:1031-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2X3 | P2rx3 | Purinergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:44397.63
Organism:RAT
Description:Purinergic, P2X3 0 RAT::P49654
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGFGRYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPENEEKYRCVSDS
QCGPERFPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVEMPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTDKDIKRCRFHPEKAPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDGVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADHYKARKFEE
VTETTLKGTASTNPVFASDQATVEKQSTDSGAYSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50415550
n/a
NameBDBM50415550
Synonyms:CHEMBL599760 | Ro-85
TypeSmall organic molecule
Emp. Form.C22H27N5O2S
Mol. Mass.425.547
SMILESC[C@H](CN1CCN(CC1)C(C)=O)NC(=O)c1cc2c(nn(C)c2s1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: