Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 6
LigandBDBM50415563
Substrate/Competitorn/a
Meas. Tech.ChEMBL_612726
IC50>10000±n/a nM
Citation Brotherton-Pleiss CEDillon MPFord APGever JRCarter DSGleason SKLin CJMoore AGThompson AWVilla MZhai Y Discovery and optimization of RO-85, a novel drug-like, potent, and selective P2X3 receptor antagonist. Bioorg Med Chem Lett 20:1031-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 6
Name:P2X purinoceptor 6
Synonyms:ATP receptor | P2X6 | P2XM | Purinergic receptor | Purinergic receptor P2X-like 1
Type:PROTEIN
Mol. Mass.:48834.61
Organism:Homo sapiens (Human)
Description:ChEMBL_612726
Residue:441
Sequence:
MCPQLAGAGSMGSPGATTGWGLLDYKTEKYVMTRNWRVGALQRLLQFGIVVYVVGWALLA
KKGYQERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTP
AQVQGRCPEHPSVPLANCWVDEDCPEGEGGTHSHGVKTGQCVVFNGTHRTCEIWSWCPVE
SGVVPSRPLLAQAQNFTLFIKNTVTFSKFNFSKSNALETWDPTYFKHCRYEPQFSPYCPV
FRIGDLVAKAGGTFEDLALLGGSVGIRVHWDCDLDTGDSGCWPHYSFQLQEKSYNFRTAT
HWWEQPGVEARTLLKLYGIRFDILVTGQAGKFGLIPTAVTLGTGAAWLGVVTFFCDLLLL
YVDREAHFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQT
QTPGWPCPSSDTHLPTHSGSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50415563
n/a
NameBDBM50415563
Synonyms:CHEMBL605325
TypeSmall organic molecule
Emp. Form.C24H30N6O2
Mol. Mass.434.534
SMILESCCCc1nc(oc1C(=O)NC(C)CN1CCN(CC1)c1ncccn1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: