Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM50417103
Substrate/Competitorn/a
Meas. Tech.ChEMBL_665339
Ki 251.19±n/a nM
Citation de Kloe GERetra KGeitmann MKällblad PNahar Tvan Elk RSmit ABvan Muijlwijk-Koezen JELeurs RIrth HDanielson UHde Esch IJ Surface plasmon resonance biosensor based fragment screening using acetylcholine binding protein identifies ligand efficiency hot spots (LE hot spots) by deconstruction of nicotinic acetylcholine receptora7 ligands. J Med Chem 53:7192-201 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:ACh-binding protein | Acetylcholine-binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP
Type:n/a
Mol. Mass.:26055.52
Organism:Lymnaea stagnalis
Description:Soluble acetylcholine receptor
Residue:229
Sequence:
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50417103
n/a
NameBDBM50417103
Synonyms:CHEMBL1256001
TypeSmall organic molecule
Emp. Form.C13H18N2O
Mol. Mass.218.2948
SMILESO[C@@H]1C2CCN(CC2)[C@H]1Cc1cccnc1 |r,wU:1.0,wD:8.10,TLB:9:8:4.3:6.7,THB:0:1:4.3:6.7,(-8.12,-33.73,;-9.46,-34.48,;-10.93,-33.84,;-12.29,-34.45,;-12.57,-35.84,;-11.19,-35.21,;-11.45,-33.31,;-11,-32.2,;-9.66,-35.86,;-8.9,-37.2,;-9.68,-38.53,;-11.22,-38.51,;-12.01,-39.83,;-11.25,-41.17,;-9.69,-41.18,;-8.92,-39.86,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: