Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin D receptor
LigandBDBM50388434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_695917
Ki 0.007±n/a nM
Citation Grzywacz PChiellini GPlum LAClagett-Dame MDeLuca HF Removal of the 26-methyl group from 19-nor-1a,25-dihydroxyvitamin D3 markedly reduces in vivo calcemic activity without altering in vitro VDR binding, HL-60 cell differentiation, and transcription. J Med Chem 53:8642-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin D receptor
Name:Vitamin D receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47811.07
Organism:Rattus norvegicus
Description:ChEMBL_1505946
Residue:423
Sequence:
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388434
n/a
NameBDBM50388434
Synonyms:CHEMBL605525
TypeSmall organic molecule
Emp. Form.C27H44O3
Mol. Mass.416.6365
SMILES[#6]-[#6@@H](-[#6]-[#6]-[#6]C([#6])([#6])[#8])-[#6@H]1-[#6]-[#6]-[#6@H]2\[#6](-[#6]-[#6]-[#6][C@]12[#6])=[#6]\[#6]=[#6]-1\[#6]-[#6@@H](-[#8])-[#6](=[#6])-[#6@H](-[#8])-[#6]-1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: