Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1A1
LigandBDBM50027799
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774161
Ki 2700±n/a nM
Citation Fontana EDansette PMPoli SM Cytochrome p450 enzymes mechanism based inhibitors: common sub-structures and reactivity. Curr Drug Metab 6:413-54 (2005) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1A1
Name:Cytochrome P450 1A1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:59401.56
Organism:Rattus norvegicus
Description:ChEMBL_774160
Residue:524
Sequence:
MPSVYGFPAFTSATELLLAVTTFCLGFWVVRVTRTWVPKGLKSPPGPWGLPFIGHVLTLG
KNPHLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLIA
NGQSMTFNPDSGPLWAARRRLAQNALKSFSIASDPTLASSCYLEEHVSKEAEYLISKFQK
LMAEVGHFDPFKYLVVSVANVICAICFGRRYDHDDQELLSIVNLSNEFGEVTGSGYPADF
IPILRYLPNSSLDAFKDLNKKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRRLDE
NANVQLSDDKVITIVFDLFGAGFDTITTAISWSLMYLVTNPRIQRKIQEELDTVIGRDRQ
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTIRDTSLNGFYIPKGHCVFVNQWQVNH
DQELWGDPNEFRPERFLTSSGTLDKHLSEKVILFGLGKRKCIGETIGRLEVFLFLAILLQ
QMEFNVSPGEKVDMTPAYGLTLKHARCEHFQVQMRSSGPQHLQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027799
n/a
NameBDBM50027799
Synonyms:CHEMBL1908215 | N-(2-Pnitrophenethyl) Dichloro Acetamide
TypeSmall organic molecule
Emp. Form.C10H10Cl2N2O3
Mol. Mass.277.104
SMILES[O-][N+](=O)c1ccc(CCNC(=O)C(Cl)Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: