Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetfMet-Leu-Phe receptor
LigandBDBM50418334
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744770
IC50 25119±n/a nM
Citation Unitt JFagura MPhillips TKing SPerry MMorley AMacDonald CWeaver RChristie JBarber SMohammed RPaul MCook ABaxter A Discovery of small molecule human FPR1 receptor antagonists. Bioorg Med Chem Lett 21:2991-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
fMet-Leu-Phe receptor
Name:fMet-Leu-Phe receptor
Synonyms:FPR | Fpr1 | N-formyl peptide receptor | N-formylpeptide chemoattractant receptor | fMLP receptor
Type:PROTEIN
Mol. Mass.:40342.61
Organism:Mus musculus
Description:ChEMBL_744770
Residue:364
Sequence:
MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDVFSYLIFAVTFVLGVLGNGLVIWVAG
FRMKHTVTTISYLNLAIADFCFTSTLPFYIASMVMGGHWPFGWFMCKFIYTVIDINLFGS
VFLIALIALDRCICVLHPVWAQNHRTVSLAKKVIIVPWICAFLLTLPVIIRLTTVPNSRL
GPGKTACTFDFSPWTKDPVEKRKVAVTMLTVRGIIRFIIGFSTPMSIVAICYGLITTKIH
RQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVALISTIQVRERLKNMTPGIVTALKITSPL
AFFNSCLNPMLYVFMGQDFRERLIHSLPASLERALTEDSAQTSDTGTNLGTNSTSLSENT
LNAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50418334
n/a
NameBDBM50418334
Synonyms:CHEMBL1770298
TypeSmall organic molecule
Emp. Form.C22H22N2O3S
Mol. Mass.394.487
SMILESCc1ccc(s1)C(NC(=O)c1ccccc1O)C(=O)Nc1c(C)cccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: