| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vasopressin V1a receptor |
|---|
| Ligand | BDBM50418402 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_746762 (CHEMBL1776931) |
|---|
| Ki | 30.9±n/a nM |
|---|
| Citation |  Napier, S; Wishart, G; Arbuckle, W; Baker, J; Barn, D; Bingham, M; Brown, A; Byford, A; Claxton, C; Craighead, M; Buchanan, K; Fielding, L; Gibson, L; Goodwin, R; Goutcher, S; Irving, N; MacSweeney, C; Milne, R; Mort, C; Presland, J; Sloan, H; Thomson, F; Turnbull, Z; Young, T The discovery of novel 8-azabicyclo[3.2.1]octan-3-yl)-3-(4-chlorophenyl) propanamides as vasopressin V1A receptor antagonists. Bioorg Med Chem Lett21:3163-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vasopressin V1a receptor |
|---|
| Name: | Vasopressin V1a receptor |
|---|
| Synonyms: | AVPR V1a | AVPR1 | AVPR1A | Antidiuretic hormone receptor 1a | V1AR_HUMAN | V1aR | VASOPRESSIN V1A | Vascular/hepatic-type arginine vasopressin receptor | Vasopressin V1 receptor | Vasopressin V1a receptor | Vasopressin receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 46820.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37288 |
|---|
| Residue: | 418 |
|---|
| Sequence: | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
|
|
|
|---|
| BDBM50418402 |
|---|
| n/a |
|---|
| Name | BDBM50418402 |
|---|
| Synonyms: | CHEMBL1773080 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H44N4O4S |
|---|
| Mol. Mass. | 592.792 |
|---|
| SMILES | COc1cc(C)c(c(C)c1C)S(=O)(=O)N[C@H](C(=O)N(CCCN1CCN(C)CC1)Cc1ccccc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
