Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM50263093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_749731 (CHEMBL1787752) |
---|
Ki | 12.59±n/a nM |
---|
Citation | Aston, NM; Bamborough, P; Buckton, JB; Edwards, CD; Holmes, DS; Jones, KL; Patel, VK; Smee, PA; Somers, DO; Vitulli, G; Walker, AL p38alpha mitogen-activated protein kinase inhibitors: optimization of a series of biphenylamides to give a molecule suitable for clinical progression. J Med Chem52:6257-69 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 41286.76 |
Organism: | Homo sapiens (Human) |
Description: | Q16539 |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM50263093 |
---|
n/a |
---|
Name | BDBM50263093 |
Synonyms: | 6-Methyl-biphenyl-3,4'-dicarboxylic acid 3-cyclopropylamide 4'-cyclopropylmethyl-amide | CHEMBL478649 | N3-cyclopropyl-N4'-(cyclopropylmethyl)-6-methylbiphenyl-3,4'-dicarboxamide | N~3~-cyclopropyl-N~4~'-(cyclopropylmethyl)-6-methylbiphenyl-3,4'-dicarboxamide |
Type | Small organic molecule |
Emp. Form. | C22H24N2O2 |
Mol. Mass. | 348.4382 |
SMILES | Cc1ccc(cc1-c1ccc(cc1)C(=O)NCC1CC1)C(=O)NC1CC1 |
Structure |
|