Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase p38
LigandBDBM50418606
Substrate/Competitorn/a
Meas. Tech.ChEMBL_749732
Ki 25.12±n/a nM
Citation Aston NMBamborough PBuckton JBEdwards CDHolmes DSJones KLPatel VKSmee PASomers DOVitulli GWalker AL p38alpha mitogen-activated protein kinase inhibitors: optimization of a series of biphenylamides to give a molecule suitable for clinical progression. J Med Chem 52:6257-69 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase p38
Name:MAP kinase p38
Synonyms:MAP kinase p38 | Mitogen-activated protein kinase 11 | Mitogen-activated protein kinase p38 beta | Stress-activated protein kinase 2 | p38-2 | p38-beta | p38b
Type:Enzyme Catalytic Domain
Mol. Mass.:41351.73
Organism:Homo sapiens (Human)
Description:gi_20128774
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50418606
n/a
NameBDBM50418606
Synonyms:CHEMBL1784172
TypeSmall organic molecule
Emp. Form.C21H22FN3O2
Mol. Mass.367.4167
SMILESCc1c(F)cc(cc1-c1ccc(cn1)C(=O)NCC1CC1)C(=O)NC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: