Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter small intestine isoform
LigandBDBM50418935
Substrate/Competitorn/a
Meas. Tech.ChEMBL_758406
Ki 251188643.15±n/a nM
Citation Thorn KNielsen CUJakobsen PSteffansen BZercher CKBegtrup M The tandem chain extension aldol reaction used for synthesis of ketomethylene tripeptidomimetics targeting hPEPT1. Bioorg Med Chem Lett 21:4597-601 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter small intestine isoform
Name:Oligopeptide transporter small intestine isoform
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Peptide transporter 1
Type:PROTEIN
Mol. Mass.:78818.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488839
Residue:708
Sequence:
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50418935
n/a
NameBDBM50418935
Synonyms:CHEMBL1807353
TypeSmall organic molecule
Emp. Form.C25H31N2O6
Mol. Mass.455.5229
SMILESCCC[C@H](NC(=O)[C@H](COC(=O)c1ccccc1)CC(=O)[C@@H]([NH3+])Cc1ccccc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: