Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
LigandBDBM50419083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_767274
IC50 3162.28±n/a nM
Citation McClure KJMaher MWu NChaplan SREckert WALee DHWickenden ADHermann MAllison BHawryluk NBreitenbucher JGGrice CA Discovery of a novel series of selective HCN1 blockers. Bioorg Med Chem Lett 21:5197-201 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
Name:Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
Synonyms:HCN3 | KIAA1535
Type:PROTEIN
Mol. Mass.:86065.62
Organism:Homo sapiens (Human)
Description:ChEMBL_767274
Residue:774
Sequence:
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419083
n/a
NameBDBM50419083
Synonyms:CHEMBL1823882
TypeSmall organic molecule
Emp. Form.C20H31N3O2
Mol. Mass.345.479
SMILESCCOc1ccccc1C(=O)NCC1(CCCCC1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: