| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orexin/Hypocretin receptor type 1 |
|---|
| Ligand | BDBM50417257 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_768077 (CHEMBL1833033) |
|---|
| Ki | 0.117±n/a nM |
|---|
| Citation |  Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M Discovery process and pharmacological characterization of a novel dual orexin 1 and orexin 2 receptor antagonist useful for treatment of sleep disorders. Bioorg Med Chem Lett21:5562-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orexin/Hypocretin receptor type 1 |
|---|
| Name: | Orexin/Hypocretin receptor type 1 |
|---|
| Synonyms: | Hcrtr1 | Hypocretin receptor type 1 | OX1R_RAT | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Ox-1-R | Ox1-R | Ox1R |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 46817.55 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P56718 |
|---|
| Residue: | 416 |
|---|
| Sequence: | MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQA
AVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFR
KLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
|
|
|
|---|
| BDBM50417257 |
|---|
| n/a |
|---|
| Name | BDBM50417257 |
|---|
| Synonyms: | SB-649868 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24FN3O3S |
|---|
| Mol. Mass. | 477.55 |
|---|
| SMILES | Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
