Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-2 adrenergic receptor
LigandBDBM50151720
Substrate/Competitorn/a
Meas. Tech.ChEMBL_773268
EC50 0.316228±n/a nM
Citation Procopiou PABarrett VJFord AJLooker BELunniss GENeedham DSmith CESomers G The discovery of long-acting saligeninß2 adrenergic receptor agonists incorporating a urea group. Bioorg Med Chem 19:6026-32 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-2 adrenergic receptor
Name:Beta-2 adrenergic receptor
Synonyms:adrenergic Beta2
Type:Enzyme Catalytic Domain
Mol. Mass.:46993.24
Organism:GUINEA PIG
Description:adrenergic Beta2 ADRB2 GUINEA PIG::Q8K4Z4
Residue:418
Sequence:
MGHLGNGSDFLLAPNASHAPDHNVTRERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMNMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWVVSGLTSFLPIQMHWYRATHKD
AINCYAEETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQKIDRSEGRF
HTQNLSQVEQDGRSGHGLRRSSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSALKAYGNDCSSNSNG
KTDYTGEPNVCHQGQEKERELLCEDPPGTEDLVSCPGTVPSDSIDSQGRNYSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151720
n/a
NameBDBM50151720
Synonyms:ARFORMOTEROL TARTRATE | CHEMBL1363 | CHEMBL605993 | FORMOTEROL | FORMOTEROL FUMARATE | Foradil | N-(2-Hydroxy-5-{1-hydroxy-2-[2-(4-methoxy-phenyl)-1-methyl-ethylamino]-ethyl}-phenyl)-formamide | N-(2-hydroxy-5-((R)-1-hydroxy-2-((R)-1-(4-methoxyphenyl)propan-2-ylamino)ethyl)phenyl)formamide | Symbicort | cid_9912089
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCOc1ccc(C[C@@H](C)NC[C@H](O)c2ccc(O)c(NC=O)c2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: