Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM50419582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795214
Ki 1.26±n/a nM
Citation Bordi FRivara SDallaturca ECarmi CPala DLodola AVacondio FFlammini LBertoni SBallabeni VBarocelli EMor M Dibasic biphenyl H3 receptor antagonists: Steric tolerance for a lipophilic side chain. Eur J Med Chem 48:214-30 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419582
n/a
NameBDBM50419582
Synonyms:CHEMBL1934064
TypeSmall organic molecule
Emp. Form.C34H44N2O2
Mol. Mass.512.7254
SMILESCOc1ccc(OCCC[C@@H](N2CCC[C@@H]2C)c2ccc(cc2)-c2ccc(CN3CCCCC3)cc2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: