Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM50419738
Substrate/Competitorn/a
Meas. Tech.ChEMBL_801487
Ki 200±n/a nM
Citation Edink EAkdemir AJansen Cvan Elk RZuiderveld Ode Kanter FJvan Muijlwijk-Koezen JESmit ABLeurs Rde Esch IJ Structure-based design, synthesis and structure-activity relationships of dibenzosuberyl- and benzoate-substituted tropines as ligands for acetylcholine-binding protein. Bioorg Med Chem Lett 22:1448-54 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:Soluble acetylcholine receptor
Type:n/a
Mol. Mass.:26560.08
Organism:Aplysia Californica
Description:Q8WSF8
Residue:236
Sequence:
MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKA
DSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLS
PQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQV
DLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419738
n/a
NameBDBM50419738
Synonyms:CHEMBL1947206
TypeSmall organic molecule
Emp. Form.C22H25NO3
Mol. Mass.351.4388
SMILESOc1cccc(CCN2[C@H]3CC[C@@H]2C[C@@H](C3)OC(=O)c2ccccc2)c1 |r,THB:7:8:15.14.13:11.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: