Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform delta
LigandBDBM50364141
Substrate/Competitorn/a
Meas. Tech.ChEMBL_842116
IC50 80±n/a nM
Citation Yang LLLi GBYan HXSun QZMa SJi PWang ZRFeng SZou JYang SY Discovery of N6-phenyl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamine derivatives as novel CK1 inhibitors using common-feature pharmacophore model based virtual screening and hit-to-lead optimization. Eur J Med Chem 56:30-38 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform delta
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364141
n/a
NameBDBM50364141
Synonyms:CHEMBL1951415
TypeSmall organic molecule
Emp. Form.C19H20FN5
Mol. Mass.337.394
SMILESNc1nccc(n1)-c1c(ncn1C1CCCCC1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: