Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransglutaminase-1 (TG1)
LigandBDBM50420522
Substrate/Competitorn/a
Meas. Tech.ChEMBL_841032
IC50 3700±n/a nM
Citation Prime MEAndersen OABarker JJBrooks MACheng RKToogood-Johnson ICourtney SMBrookfield FAYarnold CJMarston RWJohnson PDJohnsen SFPalfrey JJVaidya DErfan SIchihara OFelicetti BPalan SPedret-Dunn ASchaertl SSternberger IEbneth AScheel AWinkler DToledo-Sherman LBeconi MMacdonald DMuñoz-Sanjuan IDominguez CWityak J Discovery and structure-activity relationship of potent and selective covalent inhibitors of transglutaminase 2 for Huntington's disease. J Med Chem 55:1021-46 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transglutaminase-1 (TG1)
Name:Transglutaminase-1 (TG1)
Synonyms:Protein-glutamine gamma-glutamyltransferase K
Type:Protein
Mol. Mass.:89778.63
Organism:Homo sapiens (Human)
Description:n/a
Residue:817
Sequence:
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDD
WGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSS
RSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTH
VIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPR
NEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDI
TYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML
INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLV
DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420522
n/a
NameBDBM50420522
Synonyms:CHEMBL2089388
TypeSmall organic molecule
Emp. Form.C21H23N3O5S
Mol. Mass.429.489
SMILESC=CC(=O)Nc1ccc(cc1)S(=O)(=O)N1CCN(CC1)C(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: