Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-glutamine gamma-glutamyltransferase 2 (TG2)
LigandBDBM50420519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_841030
IC50 44±n/a nM
Citation Prime MEAndersen OABarker JJBrooks MACheng RKToogood-Johnson ICourtney SMBrookfield FAYarnold CJMarston RWJohnson PDJohnsen SFPalfrey JJVaidya DErfan SIchihara OFelicetti BPalan SPedret-Dunn ASchaertl SSternberger IEbneth AScheel AWinkler DToledo-Sherman LBeconi MMacdonald DMuñoz-Sanjuan IDominguez CWityak J Discovery and structure-activity relationship of potent and selective covalent inhibitors of transglutaminase 2 for Huntington's disease. J Med Chem 55:1021-46 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Name:Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Synonyms:Protein-glutamine gamma-glutamyltransferase | Tissue transglutaminase | Tissue transglutaminase (TG2) | Transglutaminase 2 (TGM2) | Transglutaminase C | Transglutaminase-2
Type:Protein
Mol. Mass.:77309.30
Organism:Homo sapiens (Human)
Description:P21980
Residue:687
Sequence:
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420519
n/a
NameBDBM50420519
Synonyms:CHEMBL2086519
TypeSmall organic molecule
Emp. Form.C19H25N3O5S
Mol. Mass.407.484
SMILESC=CC(=O)Nc1ccc(cc1)S(=O)(=O)N1CCN(CC1)C(=O)OC1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: