Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50420809 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_839689 (CHEMBL2090803) |
---|
Ki | 2.05±n/a nM |
---|
Citation | Pedregal, C; Joshi, EM; Toledo, MA; Lafuente, C; Diaz, N; Martinez-Grau, MA; Jiménez, A; Benito, A; Navarro, A; Chen, Z; Mudra, DR; Kahl, SD; Rash, KS; Statnick, MA; Barth, VN Development of LC-MS/MS-based receptor occupancy tracers and positron emission tomography radioligands for the nociceptin/orphanin FQ (NOP) receptor. J Med Chem55:4955-67 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50420809 |
---|
n/a |
---|
Name | BDBM50420809 |
Synonyms: | CHEMBL2088038 | CHEMBL2088039 |
Type | Small organic molecule |
Emp. Form. | C20H28N4O2S |
Mol. Mass. | 388.527 |
SMILES | CN(C)C(=O)C(CN1CCC2(CC1)OCCc1ccsc21)Cn1cccn1 |
Structure |
|