| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50420880 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_840019 (CHEMBL2090509) |
|---|
| Ki | 377±n/a nM |
|---|
| Citation |  Pasquini, S; Mugnaini, C; Ligresti, A; Tafi, A; Brogi, S; Falciani, C; Pedani, V; Pesco, N; Guida, F; Luongo, L; Varani, K; Borea, PA; Maione, S; Di Marzo, V; Corelli, F Design, synthesis, and pharmacological characterization of indol-3-ylacetamides, indol-3-yloxoacetamides, and indol-3-ylcarboxamides: potent and selective CB2 cannabinoid receptor inverse agonists. J Med Chem55:5391-402 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50420880 |
|---|
| n/a |
|---|
| Name | BDBM50420880 |
|---|
| Synonyms: | CHEMBL2087088 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N2O2 |
|---|
| Mol. Mass. | 376.4913 |
|---|
| SMILES | C=CCn1cc(CC(=O)NC2CCCCCC2)c2cc(ccc12)-c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
