Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSonic hedgehog protein
LigandBDBM50421186
Substrate/Competitorn/a
Meas. Tech.ChEMBL_839706
IC50 2.9±n/a nM
Citation Ohashi TOguro YTanaka TShiokawa ZShibata SSato YYamakawa HHattori HYamamoto YKondo SMiyamoto MTojo HBaba ASasaki S Discovery of pyrrolo[3,2-c]quinoline-4-one derivatives as novel hedgehog signaling inhibitors. Bioorg Med Chem 20:5496-506 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sonic hedgehog protein
Name:Sonic hedgehog protein
Synonyms:n/a
Type:Protein
Mol. Mass.:47784.50
Organism:Mus musculus (Mouse)
Description:Q62226
Residue:437
Sequence:
MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEARGAEPTAGIHWYSQLLYHIGTW
LLDSETMHPLGMAVKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421186
n/a
NameBDBM50421186
Synonyms:CHEMBL2086800
TypeSmall organic molecule
Emp. Form.C28H30N4O4
Mol. Mass.486.5622
SMILESCOc1c(C(=O)NCCN2CCCC2)n(C)c2c1c(=O)n(CC(=O)c1ccccc1)c1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: