Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivated CDC42 kinase 1
LigandBDBM50204587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_840100
IC50 30±n/a nM
Citation Jiao XKopecky DJLiu JLiu JJaen JCCardozo MGSharma RWalker NWesche HLi SFarrelly EXiao SHWang ZKayser F Synthesis and optimization of substituted furo[2,3-d]-pyrimidin-4-amines and 7H-pyrrolo[2,3-d]pyrimidin-4-amines as ACK1 inhibitors. Bioorg Med Chem Lett 22:6212-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activated CDC42 kinase 1
Name:Activated CDC42 kinase 1
Synonyms:ACK-1 | Ack1 | Non-receptor protein tyrosine kinase Ack
Type:PROTEIN
Mol. Mass.:116986.19
Organism:Mus musculus
Description:ChEMBL_840100
Residue:1055
Sequence:
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTLPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
AYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKREPPPRPPQPAIFTQKTTYDPVSEDP
DPLSSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPC
APSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF
EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAE
IFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEE
TSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDP
KYATPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEP
AALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRAAARLPQ
RGCPGDGQEAARPADKVQMLQAMVHGVTTEECQAALQSHSWSVQRAAQYLKVEQLFGLGL
RPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204587
n/a
NameBDBM50204587
Synonyms:(S)-6-(4-(2-(dimethylamino)ethoxy)phenyl)-5-phenyl-N-((tetrahydrofuran-2-yl)methyl)furo[2,3-d]pyrimidin-4-amine | CHEMBL247479
TypeSmall organic molecule
Emp. Form.C27H30N4O3
Mol. Mass.458.5521
SMILESCN(C)CCOc1ccc(cc1)-c1oc2ncnc(NC[C@@H]3CCCO3)c2c1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: