Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM82505
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3289
IC50 0.08±n/a nM
Citation Gaster LMJoiner GFKing FDWyman PASutton JMBingham SEllis ESSanger GJWardle KA N-[(1-butyl-4-piperidinyl)methyl]-3,4dihydro-2H-[1,3]oxazino[3,2- a]indole10-carboxamide hydrochloride: the first potent and selective 5-HT4 receptor antagonist amide with oral activity. J Med Chem 38:4760-3 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
HTR4
Name:Serotonin 4 (5-HT4) receptor
Synonyms:5-HT4 | 5-hydroxytryptamine receptor 4 | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43735.29
Organism:GUINEA PIG
Description:5-HT4 HTR4 GUINEA PIG::O70528
Residue:388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
TVECGGQWESQCHPAASSPLVAAQPIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82505
n/a
NameBDBM82505
Synonyms:CAS_121881 | NSC_121881 | SB204070
TypeSmall organic molecule
Emp. Form.C19H27ClN2O4
Mol. Mass.382.882
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: