Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor
LigandBDBM50423009
Substrate/Competitorn/a
Meas. Tech.ChEMBL_438960
Ki 55±n/a nM
Citation Trump RPCobb JEShearer BGLambert MHNolte RTWillson TMBuckholz RGZhao SMLeesnitzer LMIannone MAPearce KHBillin ANHoekstra WJ Co-crystal structure guided array synthesis of PPARgamma inverse agonists. Bioorg Med Chem Lett 17:3916-20 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma | Peroxisome proliferator-activated receptor gamma (PPAR gamma) | Peroxisome proliferator-activated receptor gamma (PPARγ) | Peroxisome proliferator-activated receptor gamma (PPARG) | Peroxisome proliferator-activated receptor gamma/Nuclear receptor corepressor 2 | peroxisome proliferator-activated receptor gamma isoform 2
Type:Nuclear Receptor
Mol. Mass.:57613.46
Organism:Homo sapiens (Human)
Description:n/a
Residue:505
Sequence:
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50423009
n/a
NameBDBM50423009
Synonyms:CHEMBL230731
TypeSmall organic molecule
Emp. Form.C38H37N3O4
Mol. Mass.599.7181
SMILESCc1oc(nc1CCOc1ccc(C[C@@H](CNC(=O)C2CC2)Nc2ccccc2C(=O)c2ccccc2)cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: