| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 12 |
|---|
| Ligand | BDBM50423388 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_457631 (CHEMBL923908) |
|---|
| IC50 | 0.32±n/a nM |
|---|
| Citation |  Springthorpe, B; Bailey, A; Barton, P; Birkinshaw, TN; Bonnert, RV; Brown, RC; Chapman, D; Dixon, J; Guile, SD; Humphries, RG; Hunt, SF; Ince, F; Ingall, AH; Kirk, IP; Leeson, PD; Leff, P; Lewis, RJ; Martin, BP; McGinnity, DF; Mortimore, MP; Paine, SW; Pairaudeau, G; Patel, A; Rigby, AJ; Riley, RJ; Teobald, BJ; Tomlinson, W; Webborn, PJ; Willis, PA From ATP to AZD6140: the discovery of an orally active reversible P2Y12 receptor antagonist for the prevention of thrombosis. Bioorg Med Chem Lett17:6013-8 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 12 |
|---|
| Name: | P2Y purinoceptor 12 |
|---|
| Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39458.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H244 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
|---|
| BDBM50423388 |
|---|
| n/a |
|---|
| Name | BDBM50423388 |
|---|
| Synonyms: | CHEMBL251024 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31N7O8S |
|---|
| Mol. Mass. | 553.589 |
|---|
| SMILES | CCCCNc1nc(SCCC)nc2n(nnc12)[C@@H]1O[C@H](\C=C\C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](O)[C@H]1O |
|---|
| Structure | 
|
|---|
Search and Browse
