Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM50025093
Substrate/Competitorn/a
Meas. Tech.ChEMBL_698608
Ki 14±n/a nM
Citation Munei YShimamoto KHarada MYoshida TChuman H Correlation analyses on binding affinity of substituted benzenesulfonamides with carbonic anhydrase using ab initio MO calculations on their complex structures (II). Bioorg Med Chem Lett 21:141-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:Carbonic anhydrase 2 | Carbonic anhydrase II | Carbonic anhydrase II (CA II) | Carbonic anhydrase II (CA-II)
Type:Enzyme Catalytic Domain
Mol. Mass.:29115.93
Organism:Bos taurus
Description:n/a
Residue:260
Sequence:
MSHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMV
NNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHL
VHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDP
GSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLM
LANWRPAQPLKNRQVRGFPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025093
n/a
NameBDBM50025093
Synonyms:4-Chloro-benzenesulfonamide | CHEMBL804 | P-Chlorobenzenesulfonamide | p-Halide-sulfanilamide derivative, 2
TypeSmall organic molecule
Emp. Form.C6H6ClNO2S
Mol. Mass.191.635
SMILESNS(=O)(=O)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: