Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEmopamil-binding protein-like
LigandBDBM20607
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936215
Ki 2.8±n/a nM
Citation Wang XLi YDeuther-Conrad WXie FChen XCui MCZhang XJZhang JMSteinbach JBrust PLiu BLJia HM Synthesis and biological evaluation of¹8F labeled fluoro-oligo-ethoxylated 4-benzylpiperazine derivatives for sigma-1 receptor imaging. Bioorg Med Chem 21:215-22 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Emopamil-binding protein-like
Name:Emopamil-binding protein-like
Synonyms:EBPL | EBRP | ERP | Emopamil-binding-related protein
Type:PROTEIN
Mol. Mass.:23203.44
Organism:Homo sapiens (Human)
Description:ChEMBL_936215
Residue:206
Sequence:
MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGP
FVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAI
VKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIP
GLLLWQSWLELKKMHQKETSSVKKFQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20607
n/a
NameBDBM20607
Synonyms:(2-{4-[(1Z)-1,2-diphenylbut-1-en-1-yl]phenoxy}ethyl)dimethylamine | 2-{4-[(1Z)-1,2-diphenylbut-1-en-1-yl]phenoxy}-N,N-dimethylethanamine | CHEMBL83 | FOSTRIECIN SODIUM | NCGC00024928 | Nolvadex | Tamoxifen | Tamoxifen (8) | Tamoxifen, 7 | cid_2733526
TypeSmall organic molecule
Emp. Form.C26H29NO
Mol. Mass.371.5146
SMILESCC\C(=C(/c1ccccc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: