| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Emopamil-binding protein-like |
|---|
| Ligand | BDBM79181 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_936215 (CHEMBL2320419) |
|---|
| Ki | 3.9±n/a nM |
|---|
| Citation |  Wang, X; Li, Y; Deuther-Conrad, W; Xie, F; Chen, X; Cui, MC; Zhang, XJ; Zhang, JM; Steinbach, J; Brust, P; Liu, BL; Jia, HM Synthesis and biological evaluation of¹8F labeled fluoro-oligo-ethoxylated 4-benzylpiperazine derivatives for sigma-1 receptor imaging. Bioorg Med Chem21:215-22 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Emopamil-binding protein-like |
|---|
| Name: | Emopamil-binding protein-like |
|---|
| Synonyms: | EBPL | EBPL_HUMAN | EBRP | ERP | Emopamil-binding-related protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23203.44 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_936215 |
|---|
| Residue: | 206 |
|---|
| Sequence: | MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGP
FVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAI
VKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIP
GLLLWQSWLELKKMHQKETSSVKKFQ
|
|
|
|---|
| BDBM79181 |
|---|
| n/a |
|---|
| Name | BDBM79181 |
|---|
| Synonyms: | 10-[3-(4-methyl-1-piperazinyl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazin-1-yl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazino)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | MLS001146870 | SMR000059133 | TRIFLUOPERAZINE | TRIFLUOPERAZINE DIHYDROCHLORIDE | Trifluperazine | US11542290, Compound Trifluoperazine | cid_2913535 | cid_5566 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24F3N3S |
|---|
| Mol. Mass. | 407.496 |
|---|
| SMILES | CN1CCN(CCCN2c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
