Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor VII/tissue factor
LigandBDBM50424070
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936735
IC50 119±n/a nM
Citation Ge HXZhang JChen LKou JPYu BY Chemical and microbial semi-synthesis of tetrahydroprotoberberines as inhibitors on tissue factor procoagulant activity. Bioorg Med Chem 21:62-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Coagulation factor VII/tissue factor
Name:Coagulation factor VII/tissue factor
Synonyms:CD_antigen=CD142 | Coagulation factor III | TF | Thromboplastin | Tissue factor
Type:PROTEIN
Mol. Mass.:33067.61
Organism:Homo sapiens (Human)
Description:ChEMBL_936735
Residue:295
Sequence:
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50424070
n/a
NameBDBM50424070
Synonyms:CHEMBL2314735
TypeSmall organic molecule
Emp. Form.C22H23NO5
Mol. Mass.381.4217
SMILESCCC(=O)Oc1c(OC)ccc2CC3N(CCc4cc5OCOc5cc34)Cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: