Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificty protein kinase CLK1
LigandBDBM100152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934298
IC50 26±n/a nM
Citation Loidreau YMarchand PDubouilh-Benard CNourrisson MRDuflos MLoaëc NMeijer LBesson T Synthesis and biological evaluation of N-aryl-7-methoxybenzo[b]furo[3,2-d]pyrimidin-4-amines and their N-arylbenzo[b]thieno[3,2-d]pyrimidin-4-amine analogues as dual inhibitors of CLK1 and DYRK1A kinases. Eur J Med Chem 59:283-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificty protein kinase CLK1
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 1 | CDC-like kinase 1 (CLK1) | CDC2-like kinase 1 (CLK1) | Dual specificity protein kinase CLK1
Type:Protein
Mol. Mass.:57322.21
Organism:Homo sapiens (Human)
Description:P49759
Residue:484
Sequence:
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM100152
n/a
NameBDBM100152
Synonyms:7-methoxy-1-methyl-9H-beta-carboline;hydrochloride | 7-methoxy-1-methyl-9H-pyrido[3,4-b]indole;hydrochloride | HARMINE | Harmine hydrochloride | MLS002153910 | SMR001233259 | cid_5359389
TypeSmall organic molecule
Emp. Form.C13H12N2O
Mol. Mass.212.2472
SMILESCOc1ccc2c(c1)[nH]c1c(C)nccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: