Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 2
LigandBDBM50216627
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934317
IC50 4400±n/a nM
Citation Wittwer MBZur AAKhuri NKido YKosaka AZhang XMorrissey KMSali AHuang YGiacomini KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem 56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 2
Name:Solute carrier family 22 member 2
Synonyms:OCT2 | Organic cation transporter 2 | SLC22A2 | hOCT2
Type:PROTEIN
Mol. Mass.:62591.01
Organism:Homo sapiens (Human)
Description:ChEMBL_1484077
Residue:555
Sequence:
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50216627
n/a
NameBDBM50216627
Synonyms:(alpha-methyl-1-adamantyl)methylamine | 1-Adamantan-1-yl-ethylamine | CHEMBL959 | RIMANTADINE | rimantadin | rimantidin
TypeSmall organic molecule
Emp. Form.C12H21N
Mol. Mass.179.3018
SMILESCC(N)C12CC3CC(CC(C3)C1)C2 |TLB:10:5:12:9.8.11,10:9:12:6.5.4,THB:4:5:8:12.3.11,4:3:6.5.10:8,1:3:6.5.10:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: