Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 1
LigandBDBM45440
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934320
IC50 2700±n/a nM
Citation Wittwer MBZur AAKhuri NKido YKosaka AZhang XMorrissey KMSali AHuang YGiacomini KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem 56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 1
Name:Multidrug and toxin extrusion protein 1
Synonyms:MATE-1 | MATE1 | SLC47A1 | Solute carrier family 47 member 1 | hMATE-1
Type:PROTEIN
Mol. Mass.:61928.01
Organism:Homo sapiens (Human)
Description:ChEMBL_934313
Residue:570
Sequence:
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM45440
n/a
NameBDBM45440
Synonyms:4-[5-(4-amidinophenoxy)pentoxy]benzamidine;2-hydroxyethanesulfonic acid | 4-[5-(4-carbamimidoylphenoxy)pentoxy]benzenecarboximidamide;2-hydroxyethanesulfonic acid | 4-[5-(4-carbamimidoylphenoxy)pentoxy]benzenecarboximidamide;2-oxidanylethanesulfonic acid | CHEMBL494163 | MLS000028738 | PENTAMIDINE | PENTAMIDINE ISETHIONATE | SMR000059147 | cid_359323
TypeSmall organic molecule
Emp. Form.C19H24N4O2
Mol. Mass.340.4195
SMILESNC(=N)c1ccc(OCCCCCOc2ccc(cc2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: