Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 1
LigandBDBM67690
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934312
IC50 190±n/a nM
Citation Wittwer MBZur AAKhuri NKido YKosaka AZhang XMorrissey KMSali AHuang YGiacomini KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem 56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 1
Name:Multidrug and toxin extrusion protein 1
Synonyms:MATE-1 | MATE1 | SLC47A1 | Solute carrier family 47 member 1 | hMATE-1
Type:PROTEIN
Mol. Mass.:61928.01
Organism:Homo sapiens (Human)
Description:ChEMBL_934313
Residue:570
Sequence:
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67690
n/a
NameBDBM67690
Synonyms:1,4-bis[2-(2-hydroxyethylamino)ethylamino]-5,8-bis(oxidanyl)anthracene-9,10-dione;hydrochloride | 1,4-dihydroxy-5,8-bis[2-(2-hydroxyethylamino)ethylamino]-9,10-anthraquinone;hydrochloride | 1,4-dihydroxy-5,8-bis[2-(2-hydroxyethylamino)ethylamino]anthracene-9,10-dione;hydrochloride | DHAD | MITOXANTRONE | MITOXANTRONE DIHYDROCHLORIDE | MLS001333711 | SMR000058480 | cid_4212 | cid_5458171
TypeSmall organic molecule
Emp. Form.C22H28N4O6
Mol. Mass.444.4809
SMILESOCCNCCNc1ccc(NCCNCCO)c2C(=O)c3c(O)ccc(O)c3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: