Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM50425147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936852
IC50 280±n/a nM
Citation Eccles WBlevitt JMBooker JNChrovian CCCrawford Sde Leon ARDeng XFourie AMGrice CAHerman KKarlsson LKearney AMLee-Dutra ALiang JLuna RPippel DRao NRiley JPSantillán ASavall BTanis VMXue XYoung AL Identification of benzofuran central cores for the inhibition of leukotriene A(4) hydrolase. Bioorg Med Chem Lett 23:811-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:69048.58
Organism:Mus musculus
Description:ChEMBL_936852
Residue:611
Sequence:
MPEVADTCSLASPASVCRTQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGES
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSV
TTDDWKSFLYSHFKDKVDLLNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLSSFSIADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT
AMLVGRDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425147
n/a
NameBDBM50425147
Synonyms:CHEMBL2313567
TypeSmall organic molecule
Emp. Form.C21H19N3O4S
Mol. Mass.409.458
SMILESOC(=O)C1CCN(Cc2coc3cc(Oc4nc5ncccc5s4)ccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: